PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G096200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 241aa    MW: 27809.6 Da    PI: 7.3907
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G096200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox542.8e-17121175256
                        T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        rk+ ++tkeq   Le+ F++n +++ +++  LAk+l+L  rqV vW+qNrRa+ k
  Aqcoe5G096200.1.p 121 RKKLRLTKEQSALLEDSFKQNTTLNPRQKLALAKQLNLRPRQVEVWYQNRRARTK 175
                        788899***********************************************98 PP

2HD-ZIP_I/II121.15.6e-39121210191
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                        +kk+rl+keq++lLE+sF+++++L+p++K +la++L+l+prqv+vW+qnrRARtk+kq+E+d+e+Lk++++al++en+rL+ke +eL+ +l
  Aqcoe5G096200.1.p 121 RKKLRLTKEQSALLEDSFKQNTTLNPRQKLALAKQLNLRPRQVEVWYQNRRARTKLKQTEVDCEYLKKWCEALTHENKRLQKELQELK-AL 210
                        69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.552117177IPR001356Homeobox domain
SMARTSM003898.3E-14119181IPR001356Homeobox domain
SuperFamilySSF466891.25E-17119178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-16121175IPR009057Homeodomain-like
PfamPF000461.1E-14121175IPR001356Homeobox domain
CDDcd000864.74E-14121178No hitNo description
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PfamPF021834.2E-11177211IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.1E-23177220IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MFQNLEIVDV CNTNLGLELG SQRMPENESK SYYEQKKPCL KYETQLVSFE PSLTLGFPDE  60
TYGTMDESRD VYGHASSHSD ISTFSNTKVK RERDLGSEEM MEIERVCGRV TTDEDDEVNA  120
RKKLRLTKEQ SALLEDSFKQ NTTLNPRQKL ALAKQLNLRP RQVEVWYQNR RARTKLKQTE  180
VDCEYLKKWC EALTHENKRL QKELQELKAL KVAPQLYMHV PAATLTMCPS CERIGRGGIH  240
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169177RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047635.12e-94Homeodomain-leucine zipper protein HD4
SwissprotP466042e-75HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A061DHW32e-94A0A061DHW3_THECC; Homeodomain-leucine zipper protein HD4
STRINGVIT_00s0732g00010.t011e-92(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.19e-66HD-ZIP family protein